PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000118810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 319aa    MW: 35110.6 Da    PI: 7.1074
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000118810genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.21.7e-33171228259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s++prsYYrCt+++C vkk+vers edp++v++tYeg+Hnh+
  MDP0000118810 171 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCGVKKRVERSYEDPSIVITTYEGQHNHQ 228
                    8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-35155230IPR003657WRKY domain
SuperFamilySSF1182905.89E-30162230IPR003657WRKY domain
PROSITE profilePS5081132.122165230IPR003657WRKY domain
SMARTSM007743.4E-39170229IPR003657WRKY domain
PfamPF031062.6E-26171228IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MSDHEPKDLY YHDLFQYEAH EHLNGGMVSI NDHQNLQGFD VNPSYMNFTE CSKGSVDYNS  60
LATAFGLSSS TSEALFSSVE GNXNAVDHLG GGGGGGGETP LTPNSSVSSS SAEADADKDC  120
GKNKKDRQPK GSSEDGDSSK KVSKPAKKKG EKKQKEPRFA FMTKSEVDHL EDGYRWRKYG  180
QKAVKNSPYP RSYYRCTTQK CGVKKRVERS YEDPSIVITT YEGQHNHQLP ATLRGNAAAA  240
LFPPSMLNLS NLAAGGPSST FPQELLFQMP QYMISSNVNQ GSSRNPNHLL QQYQLPHAAA  300
DQYGLLQDFV PSMFLKQEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-31160231778Probable WRKY transcription factor 4
2lex_A2e-31160231778Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.255061e-168fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2297719e-65KP229771.1 UNVERIFIED: Boehmeria nivea WRKY transcription factor-like (WRKY42) mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008371572.10.0PREDICTED: probable WRKY transcription factor 71
TrEMBLM5X8Q91e-135M5X8Q9_PRUPE; Uncharacterized protein
STRINGVIT_10s0003g02810.t011e-108(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22313483
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.15e-54WRKY DNA-binding protein 71